Lineage for d1kxb__ (1kxb -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.3: Viral proteases [50596] (2 proteins) Protein Viral capsid protein [50597] (2 species) Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries) 
Domain d1kxb__: 1kxb - [26390]
Details for d1kxb__
PDB Entry: 1kxb (more details), 2.9 Å
PDB Description: sindbis virus capsid (s215a mutant), tetragonal crystal form
SCOP Domain Sequences for d1kxb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxb__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdagrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew
SCOP Domain Coordinates for d1kxb__:
Click to download the PDB-style file with coordinates for d1kxb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kxb__:
- d1kxb__ appears in SCOP 1.57
- d1kxb__ appears in the current release, SCOPe 2.08, called d1kxba_
View in 3D