Lineage for d1kxb__ (1kxb -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15540Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 15566Protein Viral capsid protein [50597] (2 species)
  7. 15573Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)
  8. 15581Domain d1kxb__: 1kxb - [26390]

Details for d1kxb__

PDB Entry: 1kxb (more details), 2.9 Å

PDB Description: sindbis virus capsid (s215a mutant), tetragonal crystal form

SCOP Domain Sequences for d1kxb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxb__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdagrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1kxb__:

Click to download the PDB-style file with coordinates for d1kxb__.
(The format of our PDB-style files is described here.)

Timeline for d1kxb__: