Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (12 species) not a true protein |
Species Desulfitobacterium hafniense [TaxId:272564] [261152] (1 PDB entry) |
Domain d4rshc_: 4rsh C: [263896] automated match to d4rsha_ complexed with cl |
PDB Entry: 4rsh (more details), 2.19 Å
SCOPe Domain Sequences for d4rshc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rshc_ c.23.10.0 (C:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]} ntkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvlaek pgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntikefre wessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvl
Timeline for d4rshc_: