Lineage for d4rshb_ (4rsh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857538Species Desulfitobacterium hafniense [TaxId:272564] [261152] (1 PDB entry)
  8. 2857540Domain d4rshb_: 4rsh B: [263895]
    automated match to d4rsha_
    complexed with cl

Details for d4rshb_

PDB Entry: 4rsh (more details), 2.19 Å

PDB Description: structure of a putative lipolytic protein of g-d-s-l family from desulfitobacterium hafniense dcb-2
PDB Compounds: (B:) Lipolytic protein G-D-S-L family

SCOPe Domain Sequences for d4rshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rshb_ c.23.10.0 (B:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
ntkvvaigdsftfgypgntenswpavlgqtsqievvnkglksqtaqdlysrfdadvlaek
pgrviifvgngdaikevpletfqqhikamvekaesnhiipilalplpytgvqntikefre
wessyakeknilvldfatvlmdadnvylegllskeanypskegyklmgeyasrvl

SCOPe Domain Coordinates for d4rshb_:

Click to download the PDB-style file with coordinates for d4rshb_.
(The format of our PDB-style files is described here.)

Timeline for d4rshb_: