SCOPe 2.06: Domain d1wykd_: 1wyk D:

Lineage for d1wykd_ (1wyk D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)

8. Domain d1wykd_: 1wyk D: [26389]
   complexed with dio, for

Details for d1wykd_

PDB Entry: 1wyk, 2 Å

PDB Description: sindbis virus capsid protein (114-264)

PDB Compounds: (D:) sindbis virus capsid protein

SCOPe Domain Sequences for d1wykd_:

Sequence; same for both SEQRES and ATOM records:

>d1wykd_ b.47.1.3 (D:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
mrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvn
mrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlg
gadegtrtalsvvtwnskgktikttpegteew

Timeline for d1wykd_:

• d1wykd_ first appeared (with stable ids) in SCOP 1.55
  
• d1wykd_ appears in SCOPe 2.05
  
• d1wykd_ appears in SCOPe 2.07
  
• d1wykd_ appears in the current release, SCOPe 2.08