SCOPe 2.07: Domain d4rnld_: 4rnl D:

Lineage for d4rnld_ (4rnl D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.0: automated matches [227145] (1 protein)
   not a true family

6. Protein automated matches [226849] (8 species)
   not a true protein

7. Species Streptomyces platensis [TaxId:58346] [261282] (1 PDB entry)

8. Domain d4rnld_: 4rnl D: [263889]
   automated match to d4rnlb_
   complexed with gol, po4

Details for d4rnld_

PDB Entry: 4rnl, 1.8 Å

PDB Description: the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus

PDB Compounds: (D:) possible galactose mutarotase

SCOPe Domain Sequences for d4rnld_:

Sequence; same for both SEQRES and ATOM records:

>d4rnld_ b.30.5.0 (D:) automated matches {Streptomyces platensis [TaxId: 58346]}
rtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlalgf
adlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrvvw
darevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnhty
lnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagaydhn
faldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpaag
laletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr

Timeline for d4rnld_:

• d4rnld_ first appeared in SCOPe 2.05
  
• d4rnld_ appears in SCOPe 2.06
  
• d4rnld_ appears in the current release, SCOPe 2.08