![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Streptomyces platensis [TaxId:58346] [261282] (1 PDB entry) |
![]() | Domain d4rnld_: 4rnl D: [263889] automated match to d4rnlb_ complexed with gol, po4 |
PDB Entry: 4rnl (more details), 1.8 Å
SCOPe Domain Sequences for d4rnld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rnld_ b.30.5.0 (D:) automated matches {Streptomyces platensis [TaxId: 58346]} rtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlalgf adlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrvvw darevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnhty lnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagaydhn faldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpaag laletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
Timeline for d4rnld_: