Lineage for d4rnlc_ (4rnl C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391871Species Streptomyces platensis [TaxId:58346] [261282] (1 PDB entry)
  8. 2391874Domain d4rnlc_: 4rnl C: [263888]
    automated match to d4rnlb_
    complexed with gol, po4

Details for d4rnlc_

PDB Entry: 4rnl (more details), 1.8 Å

PDB Description: the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus
PDB Compounds: (C:) possible galactose mutarotase

SCOPe Domain Sequences for d4rnlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rnlc_ b.30.5.0 (C:) automated matches {Streptomyces platensis [TaxId: 58346]}
amrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlal
gfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrv
vwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnh
tylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagayd
hnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpa
aglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr

SCOPe Domain Coordinates for d4rnlc_:

Click to download the PDB-style file with coordinates for d4rnlc_.
(The format of our PDB-style files is described here.)

Timeline for d4rnlc_: