Lineage for d4rkrc1 (4rkr C:69-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913283Species Arthrobacter sp. [TaxId:290399] [260960] (2 PDB entries)
  8. 2913290Domain d4rkrc1: 4rkr C:69-341 [263883]
    Other proteins in same PDB: d4rkra2, d4rkrb2, d4rkrc2, d4rkrd2
    automated match to d4rkra_

Details for d4rkrc1

PDB Entry: 4rkr (more details), 2.2 Å

PDB Description: crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007, complex with lactose
PDB Compounds: (C:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d4rkrc1:

Sequence, based on SEQRES records: (download)

>d4rkrc1 c.93.1.0 (C:69-341) automated matches {Arthrobacter sp. [TaxId: 290399]}
artsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvda
vigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiay
leagsasesdepvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetd
gilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraa
vellvgllsgavtpgsqssrttlkhrlvlrest

Sequence, based on observed residues (ATOM records): (download)

>d4rkrc1 c.93.1.0 (C:69-341) automated matches {Arthrobacter sp. [TaxId: 290399]}
artsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvda
vigylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiay
leagsavpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdgilafn
dlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraavellvg
llsgavtpgsqssrttlkhrlvlrest

SCOPe Domain Coordinates for d4rkrc1:

Click to download the PDB-style file with coordinates for d4rkrc1.
(The format of our PDB-style files is described here.)

Timeline for d4rkrc1: