Lineage for d4rk1d_ (4rk1 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144114Species Enterococcus faecium [TaxId:333849] [260801] (1 PDB entry)
  8. 2144118Domain d4rk1d_: 4rk1 D: [263880]
    automated match to d4rk0d_
    complexed with cl, rib

Details for d4rk1d_

PDB Entry: 4rk1 (more details), 1.9 Å

PDB Description: Crystal structure of LacI family transcriptional regulator from Enterococcus faecium, Target EFI-512930, with bound ribose
PDB Compounds: (D:) Ribose transcriptional regulator

SCOPe Domain Sequences for d4rk1d_:

Sequence, based on SEQRES records: (download)

>d4rk1d_ c.93.1.0 (D:) automated matches {Enterococcus faecium [TaxId: 333849]}
ktigvlvpditnpffstlmrgiedilykqnfvtilcnadsdhqkeieylaeltrrgvdgf
iiatsavstdainenlkkqgrpfivldqkksegfsdavrtddfrggylagmhllslghqt
ialvypenppenvhariegfksaldvyqiphdqlillptqfskqggyqitaelldsaatg
vfalndelafglyrgleeagksipedysiigydnidmceyikpklttiaqpifelgqtsa
kllldriqfpekeweekrlpvrfekrfstaplk

Sequence, based on observed residues (ATOM records): (download)

>d4rk1d_ c.93.1.0 (D:) automated matches {Enterococcus faecium [TaxId: 333849]}
ktigvlvpditnpffstlmrgiedilykqnfvtilcnadseieylaeltrrgvdgfiiat
savstdainenlkkqgrpfivldqkksegfsdavrtddfrggylagmhllslghqtialv
ypenppenvhariegfksaldvyqiphdqlillptqfskqggyqitaelldsaatgvfal
ndelafglyrgleeagksipedysiigydnidmceyikpklttiaqpifelgqtsaklll
driqfpekeweekrlpvrfekrfstaplk

SCOPe Domain Coordinates for d4rk1d_:

Click to download the PDB-style file with coordinates for d4rk1d_.
(The format of our PDB-style files is described here.)

Timeline for d4rk1d_: