Lineage for d1wykc_ (1wyk C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406625Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2406681Protein Viral capsid protein [50597] (3 species)
  7. 2406688Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)
  8. 2406693Domain d1wykc_: 1wyk C: [26388]
    complexed with dio, for

Details for d1wykc_

PDB Entry: 1wyk (more details), 2 Å

PDB Description: sindbis virus capsid protein (114-264)
PDB Compounds: (C:) sindbis virus capsid protein

SCOPe Domain Sequences for d1wykc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wykc_ b.47.1.3 (C:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
mrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvn
mrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlg
gadegtrtalsvvtwnskgktikttpegteew

SCOPe Domain Coordinates for d1wykc_:

Click to download the PDB-style file with coordinates for d1wykc_.
(The format of our PDB-style files is described here.)

Timeline for d1wykc_: