| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins) |
| Protein automated matches [190343] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries) |
| Domain d4rhwf_: 4rhw F: [263878] Other proteins in same PDB: d4rhwa_, d4rhwb_, d4rhwc_, d4rhwd_ automated match to d3ygsp_ complexed with cl, so4 |
PDB Entry: 4rhw (more details), 2.1 Å
SCOPe Domain Sequences for d4rhwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rhwf_ a.77.1.3 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdallsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqa
Timeline for d4rhwf_: