Lineage for d4rhwf_ (4rhw F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719000Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)
  6. 2719031Protein automated matches [190343] (1 species)
    not a true protein
  7. 2719032Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries)
  8. 2719035Domain d4rhwf_: 4rhw F: [263878]
    Other proteins in same PDB: d4rhwa_, d4rhwb_, d4rhwc_, d4rhwd_
    automated match to d3ygsp_
    complexed with cl, so4

Details for d4rhwf_

PDB Entry: 4rhw (more details), 2.1 Å

PDB Description: crystal structure of apaf-1 card and caspase-9 card complex
PDB Compounds: (F:) Caspase-9

SCOPe Domain Sequences for d4rhwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rhwf_ a.77.1.3 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdallsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqa

SCOPe Domain Coordinates for d4rhwf_:

Click to download the PDB-style file with coordinates for d4rhwf_.
(The format of our PDB-style files is described here.)

Timeline for d4rhwf_: