Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.0: automated matches [191662] (1 protein) not a true family |
Protein automated matches [191250] (3 species) not a true protein |
Species Acinetobacter baumannii [TaxId:400667] [260788] (8 PDB entries) |
Domain d4rhcl_: 4rhc L: [263877] Other proteins in same PDB: d4rhca_ automated match to d4rc9d_ |
PDB Entry: 4rhc (more details), 2.68 Å
SCOPe Domain Sequences for d4rhcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rhcl_ c.23.13.0 (L:) automated matches {Acinetobacter baumannii [TaxId: 400667]} sstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdr ihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdk aigvicglgakgysfaldyaiekiq
Timeline for d4rhcl_: