| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species) protein duplication: contains two Tudor domains in tandem |
| Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
| Domain d4rg2b1: 4rg2 B:1483-1537 [263863] Other proteins in same PDB: d4rg2a2, d4rg2b2, d4rg2b3 automated match to d1ssfa1 complexed with 3oo, edo, unx |
PDB Entry: 4rg2 (more details), 1.5 Å
SCOPe Domain Sequences for d4rg2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rg2b1 b.34.9.1 (B:1483-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp
Timeline for d4rg2b1: