Class a: All alpha proteins [46456] (286 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (25 species) not a true protein |
Species Viridovipera stejnegeri [TaxId:39682] [194681] (2 PDB entries) |
Domain d4rfpa_: 4rfp A: [263862] complexed with peg |
PDB Entry: 4rfp (more details), 1.6 Å
SCOPe Domain Sequences for d4rfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rfpa_ a.133.1.2 (A:) automated matches {Viridovipera stejnegeri [TaxId: 39682]} nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep c
Timeline for d4rfpa_: