Lineage for d4rfpa_ (4rfp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733524Species Viridovipera stejnegeri [TaxId:39682] [194681] (3 PDB entries)
  8. 2733530Domain d4rfpa_: 4rfp A: [263862]
    complexed with peg

Details for d4rfpa_

PDB Entry: 4rfp (more details), 1.6 Å

PDB Description: Crystal structure of a acidic PLA2 from Trimeresurus stejnegeri venom
PDB Compounds: (A:) Acidic phospholipase A2 5

SCOPe Domain Sequences for d4rfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rfpa_ a.133.1.2 (A:) automated matches {Viridovipera stejnegeri [TaxId: 39682]}
nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
c

SCOPe Domain Coordinates for d4rfpa_:

Click to download the PDB-style file with coordinates for d4rfpa_.
(The format of our PDB-style files is described here.)

Timeline for d4rfpa_: