SCOPe 2.05: Domain d4reue_: 4reu E:

Lineage for d4reue_ (4reu E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Non-hem ferritin [63524] (6 species)

7. Species Escherichia coli [TaxId:1110693] [260578] (1 PDB entry)

8. Domain d4reue_: 4reu E: [263860]
   automated match to d4reua_
   complexed with cl, fe, hg, mes, mg, so4

Details for d4reue_

PDB Entry: 4reu, 2.5 Å

PDB Description: revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli

PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d4reue_:

Sequence; same for both SEQRES and ATOM records:

>d4reue_ a.25.1.1 (E:) Non-hem ferritin {Escherichia coli [TaxId: 1110693]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn

Timeline for d4reue_:

• d4reue_ is new in SCOPe 2.05-stable
  
• d4reue_ appears in SCOPe 2.06
  
• d4reue_ appears in the current release, SCOPe 2.08