Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries) |
Domain d4rcoa1: 4rco A:117-207 [263855] Other proteins in same PDB: d4rcoa2, d4rcob2 automated match to d4rcob1 complexed with cl |
PDB Entry: 4rco (more details), 1.9 Å
SCOPe Domain Sequences for d4rcoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rcoa1 b.40.2.0 (A:117-207) automated matches {Staphylococcus aureus [TaxId: 93061]} npkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkygegv hrnvdvfvvleennynlekysvggitksnsk
Timeline for d4rcoa1: