SCOPe 2.08: Domain d4rcoa1: 4rco A:117-207

Lineage for d4rcoa1 (4rco A:117-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries)

8. Domain d4rcoa1: 4rco A:117-207 [263855]
   Other proteins in same PDB: d4rcoa2, d4rcob2
   automated match to d4rcob1
   complexed with cl

Details for d4rcoa1

PDB Entry: 4rco, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4rcoa1:

Sequence; same for both SEQRES and ATOM records:

>d4rcoa1 b.40.2.0 (A:117-207) automated matches {Staphylococcus aureus [TaxId: 93061]}
npkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkygegv
hrnvdvfvvleennynlekysvggitksnsk

Timeline for d4rcoa1:

• d4rcoa1 first appeared in SCOPe 2.05
  
• d4rcoa1 appears in SCOPe 2.07