| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
| Family c.23.13.0: automated matches [191662] (1 protein) not a true family |
| Protein automated matches [191250] (6 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:400667] [260788] (7 PDB entries) |
| Domain d4rc9i_: 4rc9 I: [263851] automated match to d4rc9d_ complexed with so4 |
PDB Entry: 4rc9 (more details), 2.05 Å
SCOPe Domain Sequences for d4rc9i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rc9i_ c.23.13.0 (I:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
kaigvicglgakgysfaldyaiekiqpsnpn
Timeline for d4rc9i_: