Lineage for d4rc9a_ (4rc9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839934Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 1839935Protein automated matches [191250] (3 species)
    not a true protein
  7. 1839936Species Acinetobacter baumannii [TaxId:400667] [260788] (3 PDB entries)
  8. 1839937Domain d4rc9a_: 4rc9 A: [263844]
    automated match to d4rc9d_
    complexed with so4

Details for d4rc9a_

PDB Entry: 4rc9 (more details), 2.05 Å

PDB Description: Crystal Structure of the type II Dehydroquinate dehydratase from Acinetobacter baumannii at 2.03A Resolution
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4rc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rc9a_ c.23.13.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
kaigvicglgakgysfaldyaiekiqpsnpn

SCOPe Domain Coordinates for d4rc9a_:

Click to download the PDB-style file with coordinates for d4rc9a_.
(The format of our PDB-style files is described here.)

Timeline for d4rc9a_: