Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (18 PDB entries) |
Domain d4ra8c_: 4ra8 C: [263838] mutant |
PDB Entry: 4ra8 (more details), 2.6 Å
SCOPe Domain Sequences for d4ra8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ra8c_ d.9.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyv sdlels
Timeline for d4ra8c_:
View in 3D Domains from other chains: (mouse over for more information) d4ra8a_, d4ra8b_, d4ra8d_, d4ra8e_ |