Lineage for d4r9mb_ (4r9m B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575664Species Escherichia coli [TaxId:83333] [260781] (4 PDB entries)
  8. 2575673Domain d4r9mb_: 4r9m B: [263833]
    automated match to d4r9ma_
    complexed with mg

Details for d4r9mb_

PDB Entry: 4r9m (more details), 2.9 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from escherichia coli
PDB Compounds: (B:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d4r9mb_:

Sequence, based on SEQRES records: (download)

>d4r9mb_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylae

Sequence, based on observed residues (ATOM records): (download)

>d4r9mb_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqlvmrywfeepyeafvelsdlydkhihdqserrfvvecdgeka
glvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklylivdkene
kaihiyrklgfsvegelmheffingqyrnairmcifqhqylae

SCOPe Domain Coordinates for d4r9mb_:

Click to download the PDB-style file with coordinates for d4r9mb_.
(The format of our PDB-style files is described here.)

Timeline for d4r9mb_: