Lineage for d4r9kb1 (4r9k B:5-149)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505878Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 protein domains)
    automatically mapped to Pfam PF07858
  6. 2505879Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 2505880Species Rhodococcus erythropolis [TaxId:1833] [89856] (14 PDB entries)
  8. 2505886Domain d4r9kb1: 4r9k B:5-149 [263830]
    Other proteins in same PDB: d4r9kb2, d4r9kc2
    automated match to d4r9kc_
    complexed with gol, hyh; mutant

Details for d4r9kb1

PDB Entry: 4r9k (more details), 1.5 Å

PDB Description: structure of thermostable eightfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis
PDB Compounds: (B:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4r9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9kb1 d.17.4.8 (B:5-149) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ieqprwaskdpaagkastpdekivlefmdaltsndaaklikyfaedtmyqnmplppaygr
daveqtlaglfkvmsidavevfhigsskglvftervdvlralptgksynlsilgvfqltd
gkitgwrdyfdlrefeeavdlplrg

SCOPe Domain Coordinates for d4r9kb1:

Click to download the PDB-style file with coordinates for d4r9kb1.
(The format of our PDB-style files is described here.)

Timeline for d4r9kb1: