SCOPe 2.06: Domain d1kxaa_: 1kxa A:

Lineage for d1kxaa_ (1kxa A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)

8. Domain d1kxaa_: 1kxa A: [26383]

Details for d1kxaa_

PDB Entry: 1kxa, 3.1 Å

PDB Description: sindbis virus capsid, (wild-type) residues 106-264, tetragonal crystal form

PDB Compounds: (A:) sindbis virus capsid protein

SCOPe Domain Sequences for d1kxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1kxaa_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d1kxaa_:

• d1kxaa_ first appeared (with stable ids) in SCOP 1.55, called d1kxa__
  
• d1kxaa_ appears in SCOPe 2.05
  
• d1kxaa_ appears in SCOPe 2.07
  
• d1kxaa_ appears in the current release, SCOPe 2.08