Lineage for d4r7ua_ (4r7u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957306Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2957307Protein automated matches [190878] (15 species)
    not a true protein
  7. 2957368Species Vibrio cholerae [TaxId:243277] [260004] (1 PDB entry)
  8. 2957369Domain d4r7ua_: 4r7u A: [263824]
    automated match to d4r7uc_
    complexed with ffq, na, pg4, ud1

Details for d4r7ua_

PDB Entry: 4r7u (more details), 2.45 Å

PDB Description: structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from vibrio cholerae in complex with substrate udp-n-acetylglucosamine and the drug fosfomycin
PDB Compounds: (A:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d4r7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r7ua_ d.68.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mekfrvigstqplqgevtisgaknaalpilfasilaeepvevanvphlrdidttmeller
lgakverngsvhvdagpinqycapydlvktmrasiwalgplvarfgqgqvslpggcaiga
rpvdlhihgleqlgatitledgyvkahvdgrlqgahivmdkvsvgatitimcaatlaegt
tvldnaarepeivdtamflnklgakisgagtdsitiegverlgggkhavvpdrietgtfl
vaaavsrgkivcrnthahlleavlakleeagaeiecgedwisldmtgrelkavtvrtaph
pgfptdmqaqftllnmmakgggvitetifenrfmhvpelkrmgakaeiegntvicgdvdr
lsgaqvmatdlrasaslviagciakgetivdriyhidrgyeriedklsalganierfr

SCOPe Domain Coordinates for d4r7ua_:

Click to download the PDB-style file with coordinates for d4r7ua_.
(The format of our PDB-style files is described here.)

Timeline for d4r7ua_: