Lineage for d4r5ld2 (4r5l D:504-606)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986263Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1986514Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 1986515Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 1986530Protein automated matches [227118] (3 species)
    not a true protein
  7. 1986535Species Escherichia coli [TaxId:83333] [259518] (3 PDB entries)
  8. 1986545Domain d4r5ld2: 4r5l D:504-606 [263821]
    Other proteins in same PDB: d4r5la1, d4r5la3, d4r5lb1, d4r5lb3, d4r5lc1, d4r5lc3, d4r5ld1, d4r5ld3
    automated match to d4r5la2
    complexed with ca, po4, so4

Details for d4r5ld2

PDB Entry: 4r5l (more details), 2.97 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-C)
PDB Compounds: (D:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5ld2 a.8.4.1 (D:504-606) automated matches {Escherichia coli [TaxId: 83333]}
ssglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddkt
aiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqh

SCOPe Domain Coordinates for d4r5ld2:

Click to download the PDB-style file with coordinates for d4r5ld2.
(The format of our PDB-style files is described here.)

Timeline for d4r5ld2: