Lineage for d4r5ld1 (4r5l D:389-503)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824537Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2824538Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2824539Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 2824559Protein automated matches [227117] (2 species)
    not a true protein
  7. 2824564Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries)
  8. 2824574Domain d4r5ld1: 4r5l D:389-503 [263820]
    Other proteins in same PDB: d4r5la2, d4r5la3, d4r5lb2, d4r5lb3, d4r5lc2, d4r5lc3, d4r5ld2, d4r5ld3
    automated match to d4r5la1
    complexed with ca, po4, so4

Details for d4r5ld1

PDB Entry: 4r5l (more details), 2.97 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-C)
PDB Compounds: (D:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5ld1 b.130.1.1 (D:389-503) automated matches {Escherichia coli [TaxId: 83333]}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitika

SCOPe Domain Coordinates for d4r5ld1:

Click to download the PDB-style file with coordinates for d4r5ld1.
(The format of our PDB-style files is described here.)

Timeline for d4r5ld1: