Lineage for d2snwb_ (2snw B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 299596Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 299634Protein Viral capsid protein [50597] (3 species)
  7. 299641Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)
  8. 299651Domain d2snwb_: 2snw B: [26382]

Details for d2snwb_

PDB Entry: 2snw (more details), 2.7 Å

PDB Description: sindbis virus capsid protein, type3 crystal form
PDB Compounds: (B:)

SCOP Domain Sequences for d2snwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2snwb_ b.47.1.3 (B:) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d2snwb_:

Click to download the PDB-style file with coordinates for d2snwb_.
(The format of our PDB-style files is described here.)

Timeline for d2snwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2snwa_