SCOPe 2.08: Domain d2snwb_: 2snw B:

Lineage for d2snwb_ (2snw B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)

8. Domain d2snwb_: 2snw B: [26382]

Details for d2snwb_

PDB Entry: 2snw, 2.7 Å

PDB Description: sindbis virus capsid protein, type3 crystal form

PDB Compounds: (B:) coat protein c

SCOPe Domain Sequences for d2snwb_:

Sequence; same for both SEQRES and ATOM records:

>d2snwb_ b.47.1.3 (B:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d2snwb_:

• d2snwb_ first appeared (with stable ids) in SCOP 1.55
  
• d2snwb_ appears in SCOPe 2.07