![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) ![]() |
![]() | Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
![]() | Protein automated matches [227118] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [259518] (3 PDB entries) |
![]() | Domain d4r5jd2: 4r5j D:507-604 [263817] Other proteins in same PDB: d4r5ja1, d4r5ja3, d4r5jb1, d4r5jb3, d4r5jc1, d4r5jc3, d4r5jd1, d4r5jd3 automated match to d1dkxa1 complexed with ca, po4 |
PDB Entry: 4r5j (more details), 2.36 Å
SCOPe Domain Sequences for d4r5jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r5jd2 a.8.4.1 (D:507-604) automated matches {Escherichia coli [TaxId: 83333]} lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie saltaletalkgedkaaieakmqelaqvsqklmeiaqq
Timeline for d4r5jd2: