![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily) beta-sandwich: 8 strands in 2 sheets |
![]() | Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) ![]() |
![]() | Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins) |
![]() | Protein automated matches [227117] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries) |
![]() | Domain d4r5jd1: 4r5j D:384-506 [263816] Other proteins in same PDB: d4r5ja2, d4r5jb2, d4r5jc2, d4r5jd2 automated match to d1dkxa2 complexed with ca, po4 |
PDB Entry: 4r5j (more details), 2.36 Å
SCOPe Domain Sequences for d4r5jd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r5jd1 b.130.1.1 (D:384-506) automated matches {Escherichia coli [TaxId: 83333]} hhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqg erkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitika ssg
Timeline for d4r5jd1: