Lineage for d4r5jd1 (4r5j D:389-506)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824537Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2824538Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2824539Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 2824559Protein automated matches [227117] (2 species)
    not a true protein
  7. 2824564Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries)
  8. 2824570Domain d4r5jd1: 4r5j D:389-506 [263816]
    Other proteins in same PDB: d4r5ja2, d4r5ja3, d4r5jb2, d4r5jb3, d4r5jc2, d4r5jc3, d4r5jd2, d4r5jd3
    automated match to d1dkxa2
    complexed with ca, po4

Details for d4r5jd1

PDB Entry: 4r5j (more details), 2.36 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-A)
PDB Compounds: (D:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5jd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5jd1 b.130.1.1 (D:389-506) automated matches {Escherichia coli [TaxId: 83333]}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

SCOPe Domain Coordinates for d4r5jd1:

Click to download the PDB-style file with coordinates for d4r5jd1.
(The format of our PDB-style files is described here.)

Timeline for d4r5jd1: