Lineage for d4r40b_ (4r40 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2202325Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2202326Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 2202335Protein automated matches [190318] (2 species)
    not a true protein
  7. 2202345Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries)
  8. 2202349Domain d4r40b_: 4r40 B: [263811]
    Other proteins in same PDB: d4r40a1, d4r40a2, d4r40c1, d4r40c2
    automated match to d4pwta_
    complexed with fmt, gol, so4

Details for d4r40b_

PDB Entry: 4r40 (more details), 2.5 Å

PDB Description: Crystal Structure of TolB/Pal complex from Yersinia pestis.
PDB Compounds: (B:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d4r40b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r40b_ d.79.7.1 (B:) automated matches {Yersinia pestis [TaxId: 214092]}
snlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkvvvegha
dergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaafaknrra
vlvy

SCOPe Domain Coordinates for d4r40b_:

Click to download the PDB-style file with coordinates for d4r40b_.
(The format of our PDB-style files is described here.)

Timeline for d4r40b_: