![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) ![]() |
![]() | Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins) |
![]() | Protein automated matches [232579] (2 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [256380] (2 PDB entries) |
![]() | Domain d4r40a2: 4r40 A:162-430 [263810] Other proteins in same PDB: d4r40a1, d4r40b_, d4r40c1, d4r40d_ automated match to d4pwza2 complexed with fmt, gol, so4 |
PDB Entry: 4r40 (more details), 2.5 Å
SCOPe Domain Sequences for d4r40a2:
Sequence, based on SEQRES records: (download)
>d4r40a2 b.68.4.1 (A:162-430) automated matches {Yersinia pestis [TaxId: 214092]} afrtriayvvktnggkfphelrvsdydgynqfvvhrspeplmspawspdgskiayvtfes gksalviqtlangairqvasfprhngapafspdgtklafalsksgslnlyvmdlasgqis qvtdgrsnntepswfpdsqnlaytsdqggrpqvykvninggvpqritwegsqnqnadvsp dgkflvlvssnggaqhiakqdletgavqvltdtlldetpsiapngtmviysstqglgsvl qlvstdgrfkarlpatdgqvkfpawspyl
>d4r40a2 b.68.4.1 (A:162-430) automated matches {Yersinia pestis [TaxId: 214092]} afrtriayvvktnggkfphelrvsdydgynqfvvhrspeplmspawspdgskiayvtfes gksalviqtlangairqvasfprhngapafspdgtklafalsksgslnlyvmdlasgqis qvtdgrsnntepswfpdsqnlaytsdqggrpqvykvninggvpqritwegsqnqnadvsp dgkflvlvssnggaqhiakqdletgavqvltdtlldetpsiapngtmviysstqglgsvl qlvstdgrfkarlpdgqvkfpawspyl
Timeline for d4r40a2:
![]() Domains from other chains: (mouse over for more information) d4r40b_, d4r40c1, d4r40c2, d4r40d_ |