Lineage for d4r40a2 (4r40 A:162-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065584Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 2065585Family b.68.4.1: TolB, C-terminal domain [50961] (2 protein domains)
  6. 2065598Protein automated matches [232579] (2 species)
    not a true protein
  7. 2065605Species Yersinia pestis [TaxId:214092] [256380] (2 PDB entries)
  8. 2065608Domain d4r40a2: 4r40 A:162-430 [263810]
    Other proteins in same PDB: d4r40a1, d4r40b_, d4r40c1, d4r40d_
    automated match to d4pwza2
    complexed with fmt, gol, so4

Details for d4r40a2

PDB Entry: 4r40 (more details), 2.5 Å

PDB Description: Crystal Structure of TolB/Pal complex from Yersinia pestis.
PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d4r40a2:

Sequence, based on SEQRES records: (download)

>d4r40a2 b.68.4.1 (A:162-430) automated matches {Yersinia pestis [TaxId: 214092]}
afrtriayvvktnggkfphelrvsdydgynqfvvhrspeplmspawspdgskiayvtfes
gksalviqtlangairqvasfprhngapafspdgtklafalsksgslnlyvmdlasgqis
qvtdgrsnntepswfpdsqnlaytsdqggrpqvykvninggvpqritwegsqnqnadvsp
dgkflvlvssnggaqhiakqdletgavqvltdtlldetpsiapngtmviysstqglgsvl
qlvstdgrfkarlpatdgqvkfpawspyl

Sequence, based on observed residues (ATOM records): (download)

>d4r40a2 b.68.4.1 (A:162-430) automated matches {Yersinia pestis [TaxId: 214092]}
afrtriayvvktnggkfphelrvsdydgynqfvvhrspeplmspawspdgskiayvtfes
gksalviqtlangairqvasfprhngapafspdgtklafalsksgslnlyvmdlasgqis
qvtdgrsnntepswfpdsqnlaytsdqggrpqvykvninggvpqritwegsqnqnadvsp
dgkflvlvssnggaqhiakqdletgavqvltdtlldetpsiapngtmviysstqglgsvl
qlvstdgrfkarlpdgqvkfpawspyl

SCOPe Domain Coordinates for d4r40a2:

Click to download the PDB-style file with coordinates for d4r40a2.
(The format of our PDB-style files is described here.)

Timeline for d4r40a2: