SCOP 1.65: Domain d2snwa_: 2snw A:

Lineage for d2snwa_ (2snw A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)

8. Domain d2snwa_: 2snw A: [26381]

Details for d2snwa_

PDB Entry: 2snw, 2.7 Å

PDB Description: sindbis virus capsid protein, type3 crystal form

SCOP Domain Sequences for d2snwa_:

Sequence; same for both SEQRES and ATOM records:

>d2snwa_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d2snwa_:

• d2snwa_ first appeared (with stable ids) in SCOP 1.55
  
• d2snwa_ appears in SCOP 1.63
  
• d2snwa_ appears in SCOP 1.67
  
• d2snwa_ appears in the current release, SCOPe 2.08