| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) ![]() |
| Family c.51.2.0: automated matches [232575] (1 protein) not a true family |
| Protein automated matches [232576] (2 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [256379] (2 PDB entries) |
| Domain d4r40a1: 4r40 A:23-161 [263809] Other proteins in same PDB: d4r40a2, d4r40b_, d4r40c2, d4r40d_ automated match to d4pwza1 complexed with fmt, gol, so4 |
PDB Entry: 4r40 (more details), 2.5 Å
SCOPe Domain Sequences for d4r40a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r40a1 c.51.2.0 (A:23-161) automated matches {Yersinia pestis [TaxId: 214092]}
vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
ysahtvsdevfekltgikg
Timeline for d4r40a1:
View in 3DDomains from other chains: (mouse over for more information) d4r40b_, d4r40c1, d4r40c2, d4r40d_ |