SCOPe 2.08: Domain d4r40a1: 4r40 A:23-161

Lineage for d4r40a1 (4r40 A:23-161)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families)

5. Family c.51.2.0: automated matches [232575] (1 protein)
   not a true family

6. Protein automated matches [232576] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256379] (2 PDB entries)

8. Domain d4r40a1: 4r40 A:23-161 [263809]
   Other proteins in same PDB: d4r40a2, d4r40b_, d4r40c2, d4r40d_
   automated match to d4pwza1
   complexed with fmt, gol, so4

Details for d4r40a1

PDB Entry: 4r40, 2.5 Å

PDB Description: Crystal Structure of TolB/Pal complex from Yersinia pestis.

PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d4r40a1:

Sequence; same for both SEQRES and ATOM records:

>d4r40a1 c.51.2.0 (A:23-161) automated matches {Yersinia pestis [TaxId: 214092]}
vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
ysahtvsdevfekltgikg

Timeline for d4r40a1:

• d4r40a1 first appeared in SCOPe 2.05
  
• d4r40a1 appears in SCOPe 2.07