Lineage for d4r31f_ (4r31 F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2141798Species Actinobacillus succinogenes [TaxId:339671] [259290] (1 PDB entry)
  8. 2141804Domain d4r31f_: 4r31 F: [263808]
    Other proteins in same PDB: d4r31a2
    automated match to d2b94a_
    complexed with gol

Details for d4r31f_

PDB Entry: 4r31 (more details), 2 Å

PDB Description: crystal structure of a putative uridine phosphorylase from actinobacillus succinogenes 130z (target nysgrc-029667 )
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d4r31f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r31f_ c.56.2.0 (F:) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
sevfhlgltkamlkgakiavipgdparseriaqrmdkpeflassreftswlgylenepvv
vcstgiggpsvsicveelaqlgvgtflrigttgaiqpyinvgdvlvttgavrldgasrhf
apleypavadfsctnalysaavaqgitpyvgitassdtfypgqerydtfsgkvypayqgs
lkqwqdlnvmnyemesatlftmcaalglkagmvagvivnrtqqeipneatiksteqkava
vvieaarrlisag

SCOPe Domain Coordinates for d4r31f_:

Click to download the PDB-style file with coordinates for d4r31f_.
(The format of our PDB-style files is described here.)

Timeline for d4r31f_: