SCOPe 2.07: Domain d4r31a1: 4r31 A:1-255

Lineage for d4r31a1 (4r31 A:1-255)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [259290] (1 PDB entry)

8. Domain d4r31a1: 4r31 A:1-255 [263804]
   Other proteins in same PDB: d4r31a2
   automated match to d2b94a_
   complexed with gol

Details for d4r31a1

PDB Entry: 4r31, 2 Å

PDB Description: crystal structure of a putative uridine phosphorylase from actinobacillus succinogenes 130z (target nysgrc-029667 )

PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d4r31a1:

Sequence; same for both SEQRES and ATOM records:

>d4r31a1 c.56.2.0 (A:1-255) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
msevfhlgltkamlkgakiavipgdparseriaqrmdkpeflassreftswlgylenepv
vvcstgiggpsvsicveelaqlgvgtflrigttgaiqpyinvgdvlvttgavrldgasrh
fapleypavadfsctnalysaavaqgitpyvgitassdtfypgqerydtfsgkvypayqg
slkqwqdlnvmnyemesatlftmcaalglkagmvagvivnrtqqeipneatiksteqkav
avvieaarrlisagr

Timeline for d4r31a1:

• d4r31a1 first appeared in SCOPe 2.05, called d4r31a_
  
• d4r31a1 appears in SCOPe 2.06