| Class b: All beta proteins [48724] (178 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
| Protein Viral capsid protein [50597] (3 species) |
| Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries) |
| Domain d1kxfa_: 1kxf A: [26380] |
PDB Entry: 1kxf (more details), 2.38 Å
SCOPe Domain Sequences for d1kxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxfa_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
vvaivlggadegtrtalsvvtwnskgktikttpegteew
Timeline for d1kxfa_: