SCOP 1.71: Domain d1kxf__: 1kxf -

Lineage for d1kxf__ (1kxf -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)

8. Domain d1kxf__: 1kxf - [26380]

Details for d1kxf__

PDB Entry: 1kxf, 2.38 Å

PDB Description: sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)

SCOP Domain Sequences for d1kxf__:

Sequence; same for both SEQRES and ATOM records:

>d1kxf__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
vvaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d1kxf__:

• d1kxf__ first appeared (with stable ids) in SCOP 1.55
  
• d1kxf__ appears in SCOP 1.69
  
• d1kxf__ is called d1kxfa_ in SCOP 1.73
  
• d1kxf__ appears in the current release, SCOPe 2.08, called d1kxfa_