![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein Viral capsid protein [50597] (3 species) |
![]() | Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries) |
![]() | Domain d1kxf__: 1kxf - [26380] |
PDB Entry: 1kxf (more details), 2.38 Å
SCOP Domain Sequences for d1kxf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxf__ b.47.1.3 (-) Viral capsid protein {Sindbis virus} malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr vvaivlggadegtrtalsvvtwnskgktikttpegteew
Timeline for d1kxf__: