Lineage for d4r0nk_ (4r0n K:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468755Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2468796Species Mycobacterium tuberculosis [TaxId:1010836] [259023] (1 PDB entry)
  8. 2468802Domain d4r0nk_: 4r0n K: [263795]
    automated match to d4r0nc_
    complexed with so4

Details for d4r0nk_

PDB Entry: 4r0n (more details), 2 Å

PDB Description: Hexagonal form of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis
PDB Compounds: (K:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4r0nk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r0nk_ c.26.1.3 (K:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1010836]}
tgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestthl
pnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapr
ysfvssslakevamlggdvsellpepvnrrlrdrln

SCOPe Domain Coordinates for d4r0nk_:

Click to download the PDB-style file with coordinates for d4r0nk_.
(The format of our PDB-style files is described here.)

Timeline for d4r0nk_: