Lineage for d4r05b_ (4r05 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865754Species Dengue virus 3 [TaxId:11069] [260424] (3 PDB entries)
  8. 1865760Domain d4r05b_: 4r05 B: [263790]
    automated match to d2oxta_

Details for d4r05b_

PDB Entry: 4r05 (more details), 2.1 Å

PDB Description: Crystal structure of the refolded DENV3 methyltransferase
PDB Compounds: (B:) nonstructural protein ns5

SCOPe Domain Sequences for d4r05b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r05b_ c.66.1.0 (B:) automated matches {Dengue virus 3 [TaxId: 11069]}
getlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwf
vernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivk
lmsgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpy
mptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmt
hrrptiekdvdlgagtr

SCOPe Domain Coordinates for d4r05b_:

Click to download the PDB-style file with coordinates for d4r05b_.
(The format of our PDB-style files is described here.)

Timeline for d4r05b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4r05a_