Lineage for d1fiz.1 (1fiz L:,A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802336Protein Beta-acrosin [50593] (2 species)
  7. 802337Species Pig (Sus scrofa) [TaxId:9823] [50595] (1 PDB entry)
  8. 802338Domain d1fiz.1: 1fiz L:,A: [26379]
    complexed with fuc, man, nag, pbz, so4

Details for d1fiz.1

PDB Entry: 1fiz (more details), 2.9 Å

PDB Description: three dimensional structure of beta-acrosin from boar spermatozoa
PDB Compounds: (A:) beta-acrosin heavy chain, (L:) beta-acrosin light chain

SCOP Domain Sequences for d1fiz.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1fiz.1 b.47.1.2 (L:,A:) Beta-acrosin {Pig (Sus scrofa) [TaxId: 9823]}
atcdgpcglrfrqXvvggmsaepgawpwmvslqifmyhnnrryhtcggillnshwvltaa
hcfknkkkvtdwrlifganevvwgsnkpvkpplqerfveeiiihekyvsgleindialik
itppvpcgpfigpgclpqfkagpprapqtcwvtgwgylkekgprtsptlqearvalidle
lcnstrwyngrirstnvcagyprgkidtcqgdsggplmcrdraentfvvvgitswgvgca
rakrpgvytstwpylnwiaskigsnalqmvqlgtppr

SCOP Domain Coordinates for d1fiz.1:

Click to download the PDB-style file with coordinates for d1fiz.1.
(The format of our PDB-style files is described here.)

Timeline for d1fiz.1: