Lineage for d1fiz.1 (1fiz L:,A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14974Protein Beta-acrosin [50593] (2 species)
  7. 14975Species Pig (Sus scrofa) [TaxId:9823] [50595] (1 PDB entry)
  8. 14976Domain d1fiz.1: 1fiz L:,A: [26379]

Details for d1fiz.1

PDB Entry: 1fiz (more details), 2.9 Å

PDB Description: three dimensional structure of beta-acrosin from boar spermatozoa
PDB Compounds: (A:) , (L:)

SCOP Domain Sequences for d1fiz.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1fiz.1 b.47.1.2 (L:,A:) Beta-acrosin {Pig (Sus scrofa)}
atcdgpcglrfrqXvvggmsaepgawpwmvslqifmyhnnrryhtcggillnshwvltaa
hcfknkkkvtdwrlifganevvwgsnkpvkpplqerfveeiiihekyvsgleindialik
itppvpcgpfigpgclpqfkagpprapqtcwvtgwgylkekgprtsptlqearvalidle
lcnstrwyngrirstnvcagyprgkidtcqgdsggplmcrdraentfvvvgitswgvgca
rakrpgvytstwpylnwiaskigsnalqmvqlgtppr

SCOP Domain Coordinates for d1fiz.1:

Click to download the PDB-style file with coordinates for d1fiz.1.
(The format of our PDB-style files is described here.)

Timeline for d1fiz.1: