Lineage for d4qy4b_ (4qy4 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (724 PDB entries)
  8. 2317635Domain d4qy4b_: 4qy4 B: [263782]
    automated match to d3uvda_
    complexed with zn

Details for d4qy4b_

PDB Entry: 4qy4 (more details), 1.97 Å

PDB Description: Crystal structure of the bromodomain of human SMARCA2
PDB Compounds: (B:) SMARCA2 protein

SCOPe Domain Sequences for d4qy4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy4b_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkikerirnhk
yrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak

SCOPe Domain Coordinates for d4qy4b_:

Click to download the PDB-style file with coordinates for d4qy4b_.
(The format of our PDB-style files is described here.)

Timeline for d4qy4b_: