SCOPe 2.05: Domain d1fiw.1: 1fiw L:,A:

Lineage for d1fiw.1 (1fiw L:,A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Beta-acrosin [50593] (2 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [50594] (1 PDB entry)

8. Domain d1fiw.1: 1fiw L:,A: [26378]
   complexed with pbz

Details for d1fiw.1

PDB Entry: 1fiw, 2.1 Å

PDB Description: three-dimensional structure of beta-acrosin from ram spermatozoa

PDB Compounds: (A:) beta-acrosin heavy chain, (L:) beta-acrosin light chain

SCOPe Domain Sequences for d1fiw.1:

Sequence; same for both SEQRES and ATOM records:

>g1fiw.1 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]}
ttcdgpcgvrfrqnXiiggqdaahgawpwmvslqiftyhnnrryhvcggsllnsqwllta
ahcfrikkkvtdwrlifgakevewgtnkpvkpplqeryvekiiihekysasseandialm
kitppvtcghfigpgclpqfragpprvpqtcwvagwgflqenarrtspmlqearvdlidl
glcnstrwyngrirstnvcagypegkidtcqgdsggplmckdsaensyvvvgitswgvgc
arakrpgvytstwsylnwiaskigstavhmiqlpt

Timeline for d1fiw.1:

• d1fiw.1 first appeared (with stable ids) in SCOP 1.55
  
• d1fiw.1 appears in SCOPe 2.04
  
• d1fiw.1 appears in SCOPe 2.06
  
• d1fiw.1 appears in the current release, SCOPe 2.08