SCOPe 2.08: Domain d4qr0b_: 4qr0 B:

Lineage for d4qr0b_ (4qr0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.0: automated matches [191564] (1 protein)
   not a true family

6. Protein automated matches [190980] (6 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:301447] [261263] (3 PDB entries)

8. Domain d4qr0b_: 4qr0 B: [263778]
   automated match to d4qr0a_

Details for d4qr0b_

PDB Entry: 4qr0, 2.4 Å

PDB Description: Crystal structure of Streptococcus pyogenes Cas2 at pH 5.6

PDB Compounds: (B:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d4qr0b_:

Sequence; same for both SEQRES and ATOM records:

>d4qr0b_ d.58.58.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mmvlvtydvntetpagrkrlrhvaklcvdygqrvqnsvfecsvtpaefvdikhrltqiid
ektdsirfyllgknwqrrvetl

Timeline for d4qr0b_:

• d4qr0b_ first appeared in SCOPe 2.05
  
• d4qr0b_ appears in SCOPe 2.07