Lineage for d4qq7a1 (4qq7 A:1-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879321Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries)
  8. 2879324Domain d4qq7a1: 4qq7 A:1-78 [263776]
    Other proteins in same PDB: d4qq7a2, d4qq7a3, d4qq7b2, d4qq7b3
    automated match to d3mdkb1
    complexed with glo, gsh

Details for d4qq7a1

PDB Entry: 4qq7 (more details), 2.2 Å

PDB Description: crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
PDB Compounds: (A:) Putative stringent starvation protein A

SCOPe Domain Sequences for d4qq7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qq7a1 c.47.1.0 (A:1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlfnkpedisvmnpygqvpilverdlil
yesniineyiderfphpq

SCOPe Domain Coordinates for d4qq7a1:

Click to download the PDB-style file with coordinates for d4qq7a1.
(The format of our PDB-style files is described here.)

Timeline for d4qq7a1: