| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries) |
| Domain d4qq7a1: 4qq7 A:1-78 [263776] Other proteins in same PDB: d4qq7a2, d4qq7a3, d4qq7b2, d4qq7b3 automated match to d3mdkb1 complexed with glo, gsh |
PDB Entry: 4qq7 (more details), 2.2 Å
SCOPe Domain Sequences for d4qq7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qq7a1 c.47.1.0 (A:1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlfnkpedisvmnpygqvpilverdlil
yesniineyiderfphpq
Timeline for d4qq7a1: